Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6
LigandBDBM86240
Substrate/Competitorn/a
Ki 66±n/a nM
CommentsPDSP_3077
Citation Vailati SMoretti MLonghi RRovati GEClementi FGotti C Developmental expression of heteromeric nicotinic receptor subtypes in chick retina. Mol Pharmacol 63:1329-37 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6
Name:Cholinergic, Nicotinic Alpha6
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57501.33
Organism:Chick
Description:Cholinergic, Nicotinic Alpha6 0 Chick::P49581
Residue:494
Sequence:
MHPKRRLCWCLPASGAWAFMLTSLIADTTACESEERLFHKLFSRYNQFIRPVENVSDPVT
VHFELAITQLTNVDEVNQIMETNLWLRHIWNDYKLRRDPREYDGIEFVRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLRYDGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAKIDLLIIGSKVDMNEFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIVITVFVLNIHYRTPTTHTMPKWVKTVFLSLLPKVLLMQRPLE
QEKKNISKKTKKGSAKTSGKSKHSKHKDNKLHKEQRCCHCDKADDLTSTRRSRLSHQSLK
WMAEHTEYSPEVKDVINNVQFIAENMKSQNETKEVEDDWKYVAMVIDRVFLWVFIILCVF
GTAGLFIQPLIADT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86240
n/a
NameBDBM86240
Synonyms:Alpha-Conotoxin MII | Gly-L-Cys(1)-L-Cys(2)-L-Ser-L-Asn-L-Pro-L-Val-L-Cys(1)-L-His-L-Leu-L-Glu-L-His-L-Ser-L-Asn-L-Leu-L-Cys(2)-NH2
TypeSmall organic molecule
Emp. Form.C67H103N23O22S4
Mol. Mass.1710.936
SMILESCC(C)C[C@@H]1NC(=O)[C@H](Cc2cnc[nH]2)NC(=O)[C@@H]2CSSC[C@H](NC(=O)CN)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc3cnc[nH]3)NC(=O)[C@H](CCC(O)=O)NC1=O)C(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: