Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta2
LigandBDBM86241
Substrate/Competitorn/a
Ki 502±n/a nM
CommentsPDSP_666
Citation Vailati SMoretti MLonghi RRovati GEClementi FGotti C Developmental expression of heteromeric nicotinic receptor subtypes in chick retina. Mol Pharmacol 63:1329-37 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta2
Name:Cholinergic, Nicotinic Alpha6Beta2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57960.28
Organism:Chick
Description:Cholinergic, Nicotinic Alpha6Beta2 0 Chick::F7CGJ7
Residue:499
Sequence:
MLTDKCLGLFHSRLYLWAFILTLFFKAKTGCAVCEPEERLFQKLFSHYNQFIRPVENVSD
PVTVHFEVAISQLANVDEVNQIMETNLWLRHIWNDYKLRWNPGEYDGIEFVRVPADKIWK
PDIVLYNNAVGDFQVEGKTKALLKYDGMINWTPPAIFKSSCPMDITFFPFDHQNCSLKFG
SWTYDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYLR
RLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTS
LVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPRVLMMKR
PLEKKVEKFSDKDSKGFARKLAKMNYGEDAKSIKERGCCQCNPSNELSSNKRRLSYHSLK
WMTELLQYSSEVTDVIDSVQFIAENMRNQNETKEVEDDWKYVAMVVDRVFLWVFIIVCVF
GTAGLFLQPLIGNTTSSNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86241
n/a
NameBDBM86241
Synonyms:CAS_23255-54-1 | Dihydro-Beta-erythroidine | NSC_31762
TypeSmall organic molecule
Emp. Form.C16H21NO3
Mol. Mass.275.3428
SMILESCOC1CC=C2CCN3CCC4=C(CC(=O)OC4)C23C1 |t:4,11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: