Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta2
LigandBDBM50038416
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_927
Citation Vailati SMoretti MLonghi RRovati GEClementi FGotti C Developmental expression of heteromeric nicotinic receptor subtypes in chick retina. Mol Pharmacol 63:1329-37 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta2
Name:Cholinergic, Nicotinic Alpha6Beta2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57960.28
Organism:Chick
Description:Cholinergic, Nicotinic Alpha6Beta2 0 Chick::F7CGJ7
Residue:499
Sequence:
MLTDKCLGLFHSRLYLWAFILTLFFKAKTGCAVCEPEERLFQKLFSHYNQFIRPVENVSD
PVTVHFEVAISQLANVDEVNQIMETNLWLRHIWNDYKLRWNPGEYDGIEFVRVPADKIWK
PDIVLYNNAVGDFQVEGKTKALLKYDGMINWTPPAIFKSSCPMDITFFPFDHQNCSLKFG
SWTYDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYLR
RLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTS
LVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPRVLMMKR
PLEKKVEKFSDKDSKGFARKLAKMNYGEDAKSIKERGCCQCNPSNELSSNKRRLSYHSLK
WMTELLQYSSEVTDVIDSVQFIAENMRNQNETKEVEDDWKYVAMVVDRVFLWVFIIVCVF
GTAGLFLQPLIGNTTSSNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038416
n/a
NameBDBM50038416
Synonyms:(1,6-trimethyl ammonium)hexane; dibromide | CHEMBL100622 | CHEMBL332524 | HEXAMETHONIUM | HEXAMETHONIUM BROMIDE | HEXAMETHONIUM CHLORIDE | Hexamethoniumdibromide | N,N,N,N'',N'',N''-Hexamethyl-1,6-hexanediaminium dibromide | N,N,N,N'',N'',N''-Hexamethylhexane-1,6-diammoniumdibromide
TypeSmall organic molecule
Emp. Form.C12H30N2
Mol. Mass.202.3789
SMILESC[N+](C)(C)CCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: