Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta4
LigandBDBM10759
Substrate/Competitorn/a
Ki 72±n/a nM
CommentsPDSP_229
Citation Vailati SMoretti MLonghi RRovati GEClementi FGotti C Developmental expression of heteromeric nicotinic receptor subtypes in chick retina. Mol Pharmacol 63:1329-37 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta4
Name:Cholinergic, Nicotinic Alpha6Beta4
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:55323.77
Organism:Chick
Description:Cholinergic, Nicotinic Alpha6Beta4 0 Chick::F6Z813
Residue:486
Sequence:
AAACPRGQGRTLVSGLIYYITGSSKTNTEEKLMDFLLKEQKYNKLIRPATNSSQLVSIEL
QVSLAQLISVNEREQIMTTNVWLKQEWTDYRLAWDPSKYQGVKILRIPAKCIWLPDIVLY
NNADGTYEVSLYTNAVVRFNGSIFWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDH
TEIDLVLKNAMASMDDFTPSGEWDIVALPGRRTINPLDPSYVDVTYDFIIKRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPSTHSMPPWVKLVFLKRLPTFLFMNRPENHPARQR
PGPRRRNRAEATSPAELYKNSMYFVNPASAGKIQDTADGTGGQRDFRLRSSKKYQPEVQE
AIDGVSFIAEHMKSDDSDQSVIEDWKYVAMVVDRLFLWIFVFVCVLGTVGLFLPPLFQNH
SPPESP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
n/a
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: