Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHRM5
LigandBDBM86292
Substrate/Competitorn/a
Ki 0.51±n/a nM
CommentsPDSP_3131
Citation De Amici MConti PFasoli EBarocelli EBallabeni VBertoni SImpicciatore MRoth BLErnsberger PDe Micheli C Synthesis and in vitro pharmacology of novel heterocyclic muscarinic ligands. Farmaco 58:739-48 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
CHRM5
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86292
n/a
NameBDBM86292
Synonyms:2-[4-(2-Methyl-1H-imidazol-1-yl)-2-butynyl]isoxazolidin-3-one sesquifumarate | CAS_0 | NSC_0
TypeSmall organic molecule
Emp. Form.C11H13N3O2
Mol. Mass.219.2398
SMILESCc1nccn1CC#CCN1OCCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: