Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-2
LigandBDBM85224
Substrate/Competitorn/a
Ki 310±n/a nM
CommentsPDSP_1165
Citation Jensen AAMikkelsen IFrølund BBräuner-Osborne HFalch EKrogsgaard-Larsen P Carbamoylcholine homologs: novel and potent agonists at neuronal nicotinic acetylcholine receptors. Mol Pharmacol 64:865-75 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor subunit alpha-2
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:Cholinergic, Nicotinic Alpha2Beta2 | Cholinergic, Nicotinic Alpha2Beta4
Type:Enzyme
Mol. Mass.:58597.25
Organism:Rattus norvegicus (Rat)
Description:P12389
Residue:511
Sequence:
MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPDLKLSPSYHWLETNMDAGEREETEEEEEEEDENICVCAGLPDSSMGVLYG
HGGLHLRAMEPETKTPSQASEILLSPQIQKALEGVHYIADRLRSEDADSSVKEDWKYVAM
VVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85224
n/a
NameBDBM85224
Synonyms:CAS_1918-18-9 | MCC | SWEP
TypeSmall organic molecule
Emp. Form.C8H7Cl2NO2
Mol. Mass.220.053
SMILESCOC(=O)Nc1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: