Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-3
LigandBDBM86311
Substrate/Competitorn/a
Ki 130±n/a nM
CommentsPDSP_609
Citation Jensen AAMikkelsen IFrølund BBräuner-Osborne HFalch EKrogsgaard-Larsen P Carbamoylcholine homologs: novel and potent agonists at neuronal nicotinic acetylcholine receptors. Mol Pharmacol 64:865-75 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor subunit alpha-3
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86311
n/a
NameBDBM86311
Synonyms:CAS_485-35-8 | Cytisine | Cytisine-(-) | NSC_22407
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESO=c1cccc2C3CNCC(C3)Cn12 |THB:4:5:11:9.8.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: