Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM82087
Substrate/Competitorn/a
Ki 23.44±n/a nM
CommentsPDSP_172
Citation Hirst WDAbrahamsen BBlaney FECalver ARAloj LPrice GWMedhurst AD Differences in the central nervous system distribution and pharmacology of the mouse 5-hydroxytryptamine-6 receptor compared with rat and human receptors investigated by radioligand binding, site-directed mutagenesis, and molecular modeling. Mol Pharmacol 64:1295-308 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82087
n/a
NameBDBM82087
Synonyms:2-(5-methoxy-1H-indol-3-yl)ethanamine | 5-MT | 5-Methoxytryptamine hydrochloride | CAS_66-83-1 | tryptamine, 5-Methoxy
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCOc1ccc2[nH]cc(CCN)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: