Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM78940
Substrate/Competitorn/a
Ki 0.56±n/a nM
CommentsPDSP_1219
Citation Hirst WDAbrahamsen BBlaney FECalver ARAloj LPrice GWMedhurst AD Differences in the central nervous system distribution and pharmacology of the mouse 5-hydroxytryptamine-6 receptor compared with rat and human receptors investigated by radioligand binding, site-directed mutagenesis, and molecular modeling. Mol Pharmacol 64:1295-308 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM78940
n/a
NameBDBM78940
Synonyms:METHIOTHEPIN | MLS000859918 | Methiothepin mesylate salt | SMR000326779 | cid_3039995 | mesylic acid;1-methyl-4-[3-(methylthio)-5,6-dihydrobenzo[b][1]benzothiepin-5-yl]piperazine | methanesulfonic acid;1-methyl-4-(3-methylsulfanyl-5,6-dihydrobenzo[b][1]benzothiepin-5-yl)piperazine | methanesulfonic acid;1-methyl-4-[3-(methylthio)-5,6-dihydrobenzo[b][1]benzothiepin-5-yl]piperazine
TypeSmall organic molecule
Emp. Form.C20H24N2S2
Mol. Mass.356.548
SMILESCSc1ccc2Sc3ccccc3CC(N3CCN(C)CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: