| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM86441 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 481±n/a nM |
|---|
| Comments | PDSP_3924 |
|---|
| Citation |  Kimura, Y; Hatanaka, K; Naitou, Y; Maeno, K; Shimada, I; Koakutsu, A; Wanibuchi, F; Yamaguchi, T Pharmacological profile of YM348, a novel, potent and orally active 5-HT2C receptor agonist. Eur J Pharmacol483:37-43 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM86441 |
|---|
| n/a |
|---|
| Name | BDBM86441 |
|---|
| Synonyms: | CAS_3045225 | NSC_3045225 | YM348 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H17N3O |
|---|
| Mol. Mass. | 243.3043 |
|---|
| SMILES | CCc1cc2c(ccc3cnn(CC(C)N)c23)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
