Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM50026203
Substrate/Competitorn/a
Ki 9±n/a nM
CommentsPDSP_4054
Citation Jarvis MFBianchi BUchic JTCartmell JLee CHWilliams MFaltynek C [3H]A-317491, a novel high-affinity non-nucleotide antagonist that specifically labels human P2X2/3 and P2X3 receptors. J Pharmacol Exp Ther 310:407-16 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2RX3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor
Type:Protein
Mol. Mass.:44292.02
Organism:Homo sapiens (Human)
Description:P56373
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026203
n/a
NameBDBM50026203
Synonyms:({[({[5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)methyl](hydroxy)phosphoryl}oxy)phosphonic acid | ATP, alpha, beta methylene | Adenosine 5'-triphosphate derivative
TypeSmall organic molecule
Emp. Form.C11H18N5O12P3
Mol. Mass.505.2082
SMILESNc1ncnc2n(cnc12)C1OC(COP(O)(=O)CP(O)(=O)OP(O)(O)=O)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: