Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 2
LigandBDBM50300129
Substrate/Competitorn/a
Ki 800±n/a nM
CommentsPDSP_3584
Citation Jarvis MFBianchi BUchic JTCartmell JLee CHWilliams MFaltynek C [3H]A-317491, a novel high-affinity non-nucleotide antagonist that specifically labels human P2X2/3 and P2X3 receptors. J Pharmacol Exp Ther 310:407-16 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 2
Name:P2X purinoceptor 2
Synonyms:ATP receptor | P2RX2 | P2X2 | Purinergic receptor | PurinergicP2X2/3
Type:Enzyme Catalytic Domain
Mol. Mass.:51765.18
Organism:Homo sapiens (Human)
Description:PurinergicP2X2/3 0 HUMAN::Q9UBL9
Residue:471
Sequence:
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQ
TQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVED
GASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFK
LGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN
FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCD
WILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300129
n/a
NameBDBM50300129
Synonyms:CHEMBL572528 | CIBACRON BLUE | Cibacron Blue 3Ga
TypeSmall organic molecule
Emp. Form.C29H20ClN7O11S3
Mol. Mass.774.157
SMILESNc1c(cc(Nc2ccc(Nc3nc(Cl)nc(Nc4ccccc4S(O)(=O)=O)n3)c(c2)S(O)(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S(O)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: