| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM86492 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.18±n/a nM |
|---|
| Comments | PDSP_2444 |
|---|
| Citation |  Valenzano, KJ; Miller, W; Chen, Z; Shan, S; Crumley, G; Victory, SF; Davies, E; Huang, JC; Allie, N; Nolan, SJ; Rotshteyn, Y; Kyle, DJ; Broglé, K DiPOA ([8-(3,3-diphenyl-propyl)-4-oxo-1-phenyl-1,3,8-triazaspiro[4.5]dec-3-yl]-acetic acid), a novel, systemically available, and peripherally restricted mu opioid agonist with antihyperalgesic activity: I. In vitro pharmacological characterization and pharmacokinetic properties. J Pharmacol Exp Ther310:783-92 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM86492 |
|---|
| n/a |
|---|
| Name | BDBM86492 |
|---|
| Synonyms: | CAS_170713-75-4 | NSC_6324645 | Nociceptin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C61H100N22O15 |
|---|
| Mol. Mass. | 1381.5851 |
|---|
| SMILES | [#6]-[#6](-[#8])-[#6](-[#7]-[#6](=O)-[#6](-[#6]-c1ccccc1)-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6](-[#7])-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6](-[#6])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6](-[#6]-[#8])-[#6](=O)-[#7]-[#6](-[#6])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](-[#7])=O |
|---|
| Structure | 
|
|---|
Search and Browse
