Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium Channel (Ca2+ dependent)
LigandBDBM50171290
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_3734
Citation Rinaldi-Carmona MBarth FCongy CMartinez SOustric DPério APoncelet MMaruani JArnone MFinance OSoubrié PLe Fur G SR147778 [5-(4-bromophenyl)-1-(2,4-dichlorophenyl)-4-ethyl-N-(1-piperidinyl)-1H-pyrazole-3-carboxamide], a new potent and selective antagonist of the CB1 cannabinoid receptor: biochemical and pharmacological characterization. J Pharmacol Exp Ther 310:905-14 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
Potassium Channel (Ca2+ dependent)
Name:Potassium Channel (Ca2+ dependent)
Synonyms:Calcium-activated potassium channel subunit beta-1
Type:Enzyme Catalytic Domain
Mol. Mass.:21805.22
Organism:Homo sapiens (Human)
Description:Potassium Channel (Ca2+ dependent) 0 HUMAN::Q16558
Residue:191
Sequence:
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171290
n/a
NameBDBM50171290
Synonyms:5-(4-Bromo-phenyl)-1-(2,4-dichloro-phenyl)-4-ethyl-1H-pyrazole-3-carboxylic acid piperidin-1-ylamide | CHEMBL189676 | SR 147778
TypeSmall organic molecule
Emp. Form.C23H23BrCl2N4O
Mol. Mass.522.265
SMILESCCc1c(nn(c1-c1ccc(Br)cc1)-c1ccc(Cl)cc1Cl)C(=O)NN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: