| Reaction Details |
|---|
 | Report a problem with these data |
| Target | AP-4 complex subunit sigma-1 |
|---|
| Ligand | BDBM50171290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_3734 |
|---|
| Citation |  Rinaldi-Carmona, M; Barth, F; Congy, C; Martinez, S; Oustric, D; Pério, A; Poncelet, M; Maruani, J; Arnone, M; Finance, O; Soubrié, P; Le Fur, G SR147778 [5-(4-bromophenyl)-1-(2,4-dichlorophenyl)-4-ethyl-N-(1-piperidinyl)-1H-pyrazole-3-carboxamide], a new potent and selective antagonist of the CB1 cannabinoid receptor: biochemical and pharmacological characterization. J Pharmacol Exp Ther310:905-14 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| AP-4 complex subunit sigma-1 |
|---|
| Name: | AP-4 complex subunit sigma-1 |
|---|
| Synonyms: | AP-4 complex subunit sigma-1 | AP4S1 | AP4S1_HUMAN | Sigma-1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17000.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Sigma-1 0 HUMAN::Q9Y587 |
|---|
| Residue: | 144 |
|---|
| Sequence: | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
|
|
|
|---|
| BDBM50171290 |
|---|
| n/a |
|---|
| Name | BDBM50171290 |
|---|
| Synonyms: | 5-(4-Bromo-phenyl)-1-(2,4-dichloro-phenyl)-4-ethyl-1H-pyrazole-3-carboxylic acid piperidin-1-ylamide | CHEMBL189676 | SR 147778 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23BrCl2N4O |
|---|
| Mol. Mass. | 522.265 |
|---|
| SMILES | CCc1c(nn(c1-c1ccc(Br)cc1)-c1ccc(Cl)cc1Cl)C(=O)NN1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
