Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
LigandBDBM50171347
Substrate/Competitorn/a
Ki 8.71±n/a nM
CommentsPDSP_218
Citation Grinevich VPLetchworth SRLindenberger KAMenager JMary VSadieva KABuhlman LMBohme GAPradier LBenavides JLukas RJBencherif M Heterologous expression of human {alpha}6{beta}4{beta}3{alpha}5 nicotinic acetylcholine receptors: binding properties consistent with their natural expression require quaternary subunit assembly including the {alpha}5 subunit. J Pharmacol Exp Ther 312:619-26 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Name:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:51875.01
Organism:RAT
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 RAT::P20420
Residue:452
Sequence:
MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIK
FGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVL
FDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDG
SQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTL
FLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGE
YLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFT
QREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFL
LVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171347
n/a
NameBDBM50171347
Synonyms:3-(Azetidin-2-ylmethoxy)-pyridine | A-85380 | CHEMBL190589
TypeSmall organic molecule
Emp. Form.C9H12N2O
Mol. Mass.164.2044
SMILESC(Oc1cccnc1)C1CCN1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: