Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
LigandBDBM50004108
Substrate/Competitorn/a
Ki 156±n/a nM
CommentsPDSP_1311
Citation Grinevich VPLetchworth SRLindenberger KAMenager JMary VSadieva KABuhlman LMBohme GAPradier LBenavides JLukas RJBencherif M Heterologous expression of human {alpha}6{beta}4{beta}3{alpha}5 nicotinic acetylcholine receptors: binding properties consistent with their natural expression require quaternary subunit assembly including the {alpha}5 subunit. J Pharmacol Exp Ther 312:619-26 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Name:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:51875.01
Organism:RAT
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 RAT::P20420
Residue:452
Sequence:
MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIK
FGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVL
FDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDG
SQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTL
FLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGE
YLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFT
QREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFL
LVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004108
n/a
NameBDBM50004108
Synonyms:(+-)-nicotine | (R,S)-nicotine | (RS)-nicotine | 3-(1-methylpyrrolidin-2-yl)pyridine | CHEMBL440464 | Nicotin | Nicotine-(+) | Nikotin | US8609708, 54 Nicotine | US9284322, Nicotine | nicotine
TypeSmall organic molecule
Emp. Form.C10H14N2
Mol. Mass.162.2316
SMILESCN1CCCC1c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: