Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
LigandBDBM86544
Substrate/Competitorn/a
Ki 991±n/a nM
CommentsPDSP_4100
Citation Grinevich VPLetchworth SRLindenberger KAMenager JMary VSadieva KABuhlman LMBohme GAPradier LBenavides JLukas RJBencherif M Heterologous expression of human {alpha}6{beta}4{beta}3{alpha}5 nicotinic acetylcholine receptors: binding properties consistent with their natural expression require quaternary subunit assembly including the {alpha}5 subunit. J Pharmacol Exp Ther 312:619-26 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Name:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:51875.01
Organism:RAT
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 RAT::P20420
Residue:452
Sequence:
MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIK
FGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVL
FDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDG
SQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTL
FLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGE
YLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFT
QREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFL
LVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86544
n/a
NameBDBM86544
Synonyms:CAS_192231-16-6 | CHEMBL111580 | NSC_6442277 | SIB-1508Y
TypeSmall organic molecule
Emp. Form.C12H14N2
Mol. Mass.186.253
SMILESCN1CCCC1c1cncc(c1)C#C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: