Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM86543
Substrate/Competitorn/a
Ki 596±n/a nM
CommentsPDSP_4101
Citation Grinevich VPLetchworth SRLindenberger KAMenager JMary VSadieva KABuhlman LMBohme GAPradier LBenavides JLukas RJBencherif M Heterologous expression of human {alpha}6{beta}4{beta}3{alpha}5 nicotinic acetylcholine receptors: binding properties consistent with their natural expression require quaternary subunit assembly including the {alpha}5 subunit. J Pharmacol Exp Ther 312:619-26 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:Cholinergic, Nicotinic Alpha7 | Cholinergic, Nicotinic Alpha7/5-HT3 | Neuronal acetylcholine receptor (alpha7 nAChR) | Neuronal acetylcholine receptor subunit alpha 7 | Neuronal acetylcholine receptor subunit alpha-7 | Neuronal acetylcholine receptor subunit alpha-7 (nAChR alpha7) | Neuronal acetylcholine receptor subunit alpha-7 (nAChR)
Type:Enzyme
Mol. Mass.:56502.44
Organism:Rattus norvegicus (Rat)
Description:Q05941
Residue:502
Sequence:
MCGGRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86543
n/a
NameBDBM86543
Synonyms:CAS_156223-05-1 | GTS-21 | NSC_122225
TypeSmall organic molecule
Emp. Form.C19H20N2O2
Mol. Mass.308.3743
SMILESCOc1ccc(C=C2CCCN=C2c2cccnc2)c(OC)c1 |w:6.5,c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: