Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM86657 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorometric Assay |
---|
Ki | 0.32±0.0 nM |
---|
IC50 | 0.63±0.0 nM |
---|
Citation | Ziólkowska, NE; Bujacz, A; Randad, RS; Erickson, JW; Skálová, T; Hasek, J; Bujacz, G New active HIV-1 protease inhibitors derived from 3-hexanol: conformation study of the free inhibitors in crystalline state and in complex with the enzyme. Chem Biol Drug Des79:798-809 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 protease wild type |
Type: | Protein |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus |
Description: | O90785 |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM86657 |
---|
n/a |
---|
Name | BDBM86657 |
Synonyms: | 3-Hexanol derivative, 3 |
Type | Small organic molecule |
Emp. Form. | C31H36N2O6 |
Mol. Mass. | 532.6273 |
SMILES | Cc1c(O)cccc1C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C[C@H](Cc1ccccc1)NC(=O)OC1CCOC1 |r| |
Structure |
|