Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM50074629
Substrate/Competitorn/a
Ki 0.63±n/a nM
CommentsPDSP_4081
Citation Esbenshade TAFox GBKrueger KMMiller TRKang CHDenny LIWitte DGYao BBPan LWetter JMarsh KBennani YLCowart MDSullivan JPHancock AA Pharmacological properties of ABT-239 [4-(2-{2-[(2R)-2-Methylpyrrolidinyl]ethyl}-benzofuran-5-yl)benzonitrile]: I. Potent and selective histamine H3 receptor antagonist with drug-like properties. J Pharmacol Exp Ther 313:165-75 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:Histamine H3 receptor
Synonyms:HISTAMINE H3 | Histamine H3 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48753.61
Organism:GUINEA PIG
Description:HISTAMINE H3 HRH3 GUINEA PIG::Q9JI35
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF
VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT
SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG
GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE
AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074629
n/a
NameBDBM50074629
Synonyms:4-[(1R,2R)-2-(5,5-Dimethyl-hex-1-ynyl)-cyclopropyl]-1H-imidazole | CHEMBL278462 | Cipralisant
TypeSmall organic molecule
Emp. Form.C14H20N2
Mol. Mass.216.322
SMILESCC(C)(C)CCC#C[C@@H]1C[C@H]1c1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: