| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine receptor H3 |
|---|
| Ligand | BDBM50074629 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.32±n/a nM |
|---|
| Comments | PDSP_4081 |
|---|
| Citation |  Esbenshade, TA; Fox, GB; Krueger, KM; Miller, TR; Kang, CH; Denny, LI; Witte, DG; Yao, BB; Pan, L; Wetter, J; Marsh, K; Bennani, YL; Cowart, MD; Sullivan, JP; Hancock, AA Pharmacological properties of ABT-239 [4-(2-{2-[(2R)-2-Methylpyrrolidinyl]ethyl}-benzofuran-5-yl)benzonitrile]: I. Potent and selective histamine H3 receptor antagonist with drug-like properties. J Pharmacol Exp Ther313:165-75 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Histamine receptor H3 |
|---|
| Name: | Histamine receptor H3 |
|---|
| Synonyms: | HISTAMINE H3 | HRH3 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 16901.59 |
|---|
| Organism: | Dog |
|---|
| Description: | Q865E3 |
|---|
| Residue: | 147 |
|---|
| Sequence: | FLLNLAISDFLVGAFCIPLYVPYVLTGRWPFSRGLCKLWLVVDYLLCTSSVFNIVLISYD
RFLSVTRAVSYRAQQGDTRRAVQKMVLVWVLAFLLYGPAILSWEHLSGGSSIPEGHCYAE
FFYNWYFLITASTLEFFTPFLSVTFFN
|
|
|
|---|
| BDBM50074629 |
|---|
| n/a |
|---|
| Name | BDBM50074629 |
|---|
| Synonyms: | 4-[(1R,2R)-2-(5,5-Dimethyl-hex-1-ynyl)-cyclopropyl]-1H-imidazole | CHEMBL278462 | Cipralisant |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H20N2 |
|---|
| Mol. Mass. | 216.322 |
|---|
| SMILES | CC(C)(C)CCC#C[C@@H]1C[C@H]1c1cnc[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
