Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50188619 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.8±n/a nM |
---|
Comments | PDSP_4501 |
---|
Citation | Hanson, J; Rolin, S; Reynaud, D; Qiao, N; Kelley, LP; Reid, HM; Valentin, F; Tippins, J; Kinsella, BT; Masereel, B; Pace-Asciak, C; Pirotte, B; Dogné, JM In vitro and in vivo pharmacological characterization of BM-613 [N-n-pentyl-N'-[2-(4'-methylphenylamino)-5-nitrobenzenesulfonyl]urea], a novel dual thromboxane synthase inhibitor and thromboxane receptor antagonist. J Pharmacol Exp Ther313:293-301 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50188619 |
---|
n/a |
---|
Name | BDBM50188619 |
Synonyms: | 1-(2-(p-toluidino)-5-nitrophenylsulfonyl)-3-tert-butylurea | BM 573 | BM-573 | CHEMBL210602 | N-tert-butyl-N'-[2-(4-methylphenylamino)-5-nitrobenzenesulfonyl]urea |
Type | Small organic molecule |
Emp. Form. | C18H22N4O5S |
Mol. Mass. | 406.456 |
SMILES | Cc1ccc(Nc2ccc(cc2S(=O)(=O)NC(=O)NC(C)(C)C)[N+]([O-])=O)cc1 |
Structure |
|