| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Ligand | BDBM86694 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_4918 |
|---|
| Citation |  Miyata, N; Seki, T; Tanaka, Y; Omura, T; Taniguchi, K; Doi, M; Bandou, K; Kametani, S; Sato, M; Okuyama, S; Cambj-Sapunar, L; Harder, DR; Roman, RJ Beneficial effects of a new 20-hydroxyeicosatetraenoic acid synthesis inhibitor, TS-011 [N-(3-chloro-4-morpholin-4-yl) phenyl-N'-hydroxyimido formamide], on hemorrhagic and ischemic stroke. J Pharmacol Exp Ther314:77-85 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Name: | Lipopolysaccharide-induced tumor necrosis factor-alpha factor |
|---|
| Synonyms: | LITAF | LITAF_HUMAN | LPS-induced TNF-alpha factor | PIG7 | SIMPLE | Small integral membrane protein of lysosome/late endosome | TNF-alpha | p53-induced gene 7 protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17106.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | TNF-alpha 0 HUMAN::Q99732 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
|
|
|
|---|
| BDBM86694 |
|---|
| n/a |
|---|
| Name | BDBM86694 |
|---|
| Synonyms: | N'-(3-Chloro-4-morpholinophenyl)-N-hydroxyformamidine | TS-011 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14ClN3O2 |
|---|
| Mol. Mass. | 255.701 |
|---|
| SMILES | ONC=Nc1ccc(N2CCOCC2)c(Cl)c1 |w:3.3| |
|---|
| Structure | 
|
|---|
Search and Browse
