| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM26739 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_5529 |
|---|
| Citation |  Gobbi, G; Bambico, FR; Mangieri, R; Bortolato, M; Campolongo, P; Solinas, M; Cassano, T; Morgese, MG; Debonnel, G; Duranti, A; Tontini, A; Tarzia, G; Mor, M; Trezza, V; Goldberg, SR; Cuomo, V; Piomelli, D Antidepressant-like activity and modulation of brain monoaminergic transmission by blockade of anandamide hydrolysis. Proc Natl Acad Sci U S A102:18620-5 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM26739 |
|---|
| n/a |
|---|
| Name | BDBM26739 |
|---|
| Synonyms: | 3-(3-carbamoylphenyl)phenyl N-cyclohexylcarbamate | CHEMBL184238 | URB 597 | URB-597 | URB597 | US9187413, 1a (URB597) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22N2O3 |
|---|
| Mol. Mass. | 338.4003 |
|---|
| SMILES | NC(=O)c1cccc(c1)-c1cccc(OC(=O)NC2CCCCC2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
