Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1B |
---|
Ligand | BDBM26739 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_5529 |
---|
Citation | Gobbi, G; Bambico, FR; Mangieri, R; Bortolato, M; Campolongo, P; Solinas, M; Cassano, T; Morgese, MG; Debonnel, G; Duranti, A; Tontini, A; Tarzia, G; Mor, M; Trezza, V; Goldberg, SR; Cuomo, V; Piomelli, D Antidepressant-like activity and modulation of brain monoaminergic transmission by blockade of anandamide hydrolysis. Proc Natl Acad Sci U S A102:18620-5 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine receptor 1B |
---|
Name: | 5-hydroxytryptamine receptor 1B |
Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 43579.17 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
Residue: | 390 |
Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
BDBM26739 |
---|
n/a |
---|
Name | BDBM26739 |
Synonyms: | 3-(3-carbamoylphenyl)phenyl N-cyclohexylcarbamate | CHEMBL184238 | URB 597 | URB-597 | URB597 | US9187413, 1a (URB597) |
Type | Small organic molecule |
Emp. Form. | C20H22N2O3 |
Mol. Mass. | 338.4003 |
SMILES | NC(=O)c1cccc(c1)-c1cccc(OC(=O)NC2CCCCC2)c1 |
Structure |
|