Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytoplasmic tyrosine-protein kinase BMX
LigandBDBM13530
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_6372
Citation Melnick JSJanes JKim SChang JYSipes DGGunderson DJarnes LMatzen JTGarcia MEHood TLBeigi RXia GHarig RAAsatryan HYan SFZhou YGu XJSaadat AZhou VKing FJShaw CMSu AIDowns RGray NSSchultz PGWarmuth MCaldwell JS An efficient rapid system for profiling the cellular activities of molecular libraries. Proc Natl Acad Sci U S A 103:3153-8 (2006) [PubMed]  Article
More Info.:Get all data from this article
 
Cytoplasmic tyrosine-protein kinase BMX
Name:Cytoplasmic tyrosine-protein kinase BMX
Synonyms:BMX | BMX non-receptor tyrosine kinase | Bone marrow tyrosine kinase gene in chromosome X protein | Cytoplasmic tyrosine-protein kinase BMX (BMX) | ETK | Epithelial and endothelial tyrosine kinase | NTK38 | Tyrosine Kinase BMX | Tyrosine-protein kinase BMX/ETK
Type:Tyrosine-protein kinase
Mol. Mass.:78030.42
Organism:Homo sapiens (Human)
Description:P51813
Residue:675
Sequence:
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
QLLSSIEPLREKDKH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13530
n/a
NameBDBM13530
Synonyms:4-[(4-methylpiperazin-1-yl)methyl]-N-[4-methyl-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]phenyl]benzamide | CHEMBL941 | Gleevec | IMATINIB | Imatinib | Imatinib, 21 | N-(4-methyl-3-{[4-(pyridin-3-yl)pyrimidin-2-yl]amino}phenyl)-4-[(4-methylpiperazin-1-yl)methyl]benzamide | STI-571 | STI571 | US9255107, Imatinib | cid_5291 | imatinib-CD3
TypeSmall organic molecule
Emp. Form.C29H31N7O
Mol. Mass.493.6027
SMILESCN1CCN(Cc2ccc(cc2)C(=O)Nc2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: