Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEPHB1
LigandBDBM13530
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_6372
Citation Melnick JSJanes JKim SChang JYSipes DGGunderson DJarnes LMatzen JTGarcia MEHood TLBeigi RXia GHarig RAAsatryan HYan SFZhou YGu XJSaadat AZhou VKing FJShaw CMSu AIDowns RGray NSSchultz PGWarmuth MCaldwell JS An efficient rapid system for profiling the cellular activities of molecular libraries. Proc Natl Acad Sci U S A 103:3153-8 (2006) [PubMed]  Article
More Info.:Get all data from this article
 
EPHB1
Name:EPHB1
Synonyms:EPH receptor B1 | Ephrin receptor | Ephrin type-B receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:109882.53
Organism:Homo sapiens (Human)
Description:EPH receptor B1 EPHB1 HUMAN::P54762
Residue:984
Sequence:
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQISQSPTAMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13530
n/a
NameBDBM13530
Synonyms:4-[(4-methylpiperazin-1-yl)methyl]-N-[4-methyl-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]phenyl]benzamide | CHEMBL941 | Gleevec | IMATINIB | Imatinib | Imatinib, 21 | N-(4-methyl-3-{[4-(pyridin-3-yl)pyrimidin-2-yl]amino}phenyl)-4-[(4-methylpiperazin-1-yl)methyl]benzamide | STI-571 | STI571 | US9255107, Imatinib | cid_5291 | imatinib-CD3
TypeSmall organic molecule
Emp. Form.C29H31N7O
Mol. Mass.493.6027
SMILESCN1CCN(Cc2ccc(cc2)C(=O)Nc2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: