Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHERG
LigandBDBM86757
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_7627
Citation Kumar JSPrabhakaran JMajo VJMilak MSHsiung SCTamir HSimpson NRVan Heertum RLMann JJParsey RV Synthesis and in vivo evaluation of a novel 5-HT1A receptor agonist radioligand [O-methyl- 11C]2-(4-(4-(2-methoxyphenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)dione in nonhuman primates. Eur J Nucl Med Mol Imaging 34:1050-60 (2007) [PubMed]  Article
More Info.:Get all data from this article
 
HERG
Name:HERG
Synonyms:KCNH2 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:92746.99
Organism:BOVINE
Description:A5PKI1
Residue:849
Sequence:
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKGLVGSPARDTNHRAPPTSWLAAGRAKTFRLKLPALLALTARASSV
RPGSAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGRAAEERRALVGPGSPP
PPPPPPPLPACVPGPHPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMR
TGALPPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLAS
PTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWD
WLILLLVIYTAVFTPYSAAFLLKETEEAPLAPDCGYACQPLAVVDLIVDIMFIVDILINF
RTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLR
LVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGD
QIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLM
YASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGI
DMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVH
AGDLLTALYFISRGSIEILRGDVVVAILGTAGTGSWARSPCRSCRGPALEGHSPGGCGPV
TAHRGLGLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86757
n/a
NameBDBM86757
Synonyms:CAS_0 | NSC_11603174 | [11C]MMP
TypeSmall organic molecule
Emp. Form.C19H27N5O3
Mol. Mass.373.4494
SMILESCOc1ccccc1N1CCN(CCCCn2ncc(=O)n(C)c2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: