| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM87000 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_8470 |
|---|
| Citation |  Alig, L; Alsenz, J; Andjelkovic, M; Bendels, S; Bénardeau, A; Bleicher, K; Bourson, A; David-Pierson, P; Guba, W; Hildbrand, S; Kube, D; Lübbers, T; Mayweg, AV; Narquizian, R; Neidhart, W; Nettekoven, M; Plancher, JM; Rocha, C; Rogers-Evans, M; Röver, S; Schneider, G; Taylor, S; Waldmeier, P Benzodioxoles: novel cannabinoid-1 receptor inverse agonists for the treatment of obesity. J Med Chem51:2115-27 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM87000 |
|---|
| n/a |
|---|
| Name | BDBM87000 |
|---|
| Synonyms: | 1-(2,2-diphenyl-benzo[1,3]dioxole-5-sulfonyl)-4-(4-fluoro-phenyl)-1,2,3,6-tetrahydro-pyridine | CAS_10097960 | NSC_10097960 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H24FNO4S |
|---|
| Mol. Mass. | 513.579 |
|---|
| SMILES | Fc1ccc(cc1)C1=CCN(CC1)S(=O)(=O)c1ccc2OC(Oc2c1)(c1ccccc1)c1ccccc1 |t:8| |
|---|
| Structure | 
|
|---|
Search and Browse
