Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR2
LigandBDBM21278
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_7040
Citation Wang HDuffy RABoykow GCChackalamannil SMadison VS Identification of novel cannabinoid CB1 receptor antagonists by using virtual screening with a pharmacophore model. J Med Chem 51:2439-46 (2008) [PubMed]  Article
More Info.:Get all data from this article
 
CNR2
Name:CNR2
Synonyms:CANNABINOID CB2 | GTP-binding nuclear protein GSP2/CNR2
Type:Enzyme Catalytic Domain
Mol. Mass.:24990.72
Organism:Saccharomyces cerevisiae
Description:CANNABINOID CB2 CNR2 0::P32836
Residue:220
Sequence:
MSAPAQNNAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFG
EIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPI
VLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
ASPALAPPEVQVDEQLMHQYQQEMDQATALPLPDEDDADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21278
n/a
NameBDBM21278
Synonyms:5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide | Acomplia | CHEMBL111 | CHEMBL558598 | RIMONABANT HYDROCHLORIDE | Rimonabant | SR 141716A | SR141716 | SR141716A | [3H]Rimonabant | [3H]SR141716A
TypeSmall organic molecule
Emp. Form.C22H21Cl3N4O
Mol. Mass.463.787
SMILESCc1c(nn(c1-c1ccc(Cl)cc1)-c1ccc(Cl)cc1Cl)C(=O)NN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: