BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM87579
Substrate/Competitorn/a
Meas. Tech.JHICC_CHT_Inh_3H uptake_CRC
IC50 446.683592±n/a nM
Citation PubChem PC JHICC_CHT_Inh_3H uptake_CRC PubChem Bioassay (2012)[AID]  Article
More Info.:Get all data from this article,  Assay Method
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM87579
n/a
NameBDBM87579
Synonyms:MLS001239889 | N-(4-{[(2,6-dimethyl-4-pyrimidinyl)amino]sulfonyl}phenyl)-2,3,4,5,6-pentafluorobenzamide | N-[4-[(2,6-dimethyl-4-pyrimidinyl)sulfamoyl]phenyl]-2,3,4,5,6-pentafluorobenzamide | N-[4-[(2,6-dimethylpyrimidin-4-yl)sulfamoyl]phenyl]-2,3,4,5,6-pentafluoro-benzamide | N-[4-[(2,6-dimethylpyrimidin-4-yl)sulfamoyl]phenyl]-2,3,4,5,6-pentafluorobenzamide | N-[4-[(2,6-dimethylpyrimidin-4-yl)sulfamoyl]phenyl]-2,3,4,5,6-pentakis(fluoranyl)benzamide | SMR000673289 | cid_1744440
TypeSmall organic molecule
Emp. Form.C19H13F5N4O3S
Mol. Mass.472.389
SMILESCc1cc(NS(=O)(=O)c2ccc(NC(=O)c3c(F)c(F)c(F)c(F)c3F)cc2)nc(C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: