Reaction Details |
| Report a problem with these data |
Target | 26S proteasome non-ATPase regulatory subunit 14 |
---|
Ligand | BDBM46319 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay |
---|
IC50 | 2930±220 nM |
---|
Citation | PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
26S proteasome non-ATPase regulatory subunit 14 |
---|
Name: | 26S proteasome non-ATPase regulatory subunit 14 |
Synonyms: | 26S Proteasome regulatory subunit Rpn11 (Rpn11) | POH1 | PSDE_HUMAN | PSMD14 | PSMD14 protein |
Type: | Protein |
Mol. Mass.: | 34576.68 |
Organism: | Homo sapiens (Human) |
Description: | O00487 |
Residue: | 310 |
Sequence: | MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
|
|
|
BDBM46319 |
---|
n/a |
---|
Name | BDBM46319 |
Synonyms: | 3-[(5Z)-5-[[5-(1,3-benzothiazol-2-yl)-2-furanyl]methylidene]-4-oxo-2-sulfanylidene-3-thiazolidinyl]propanoic acid | 3-[(5Z)-5-[[5-(1,3-benzothiazol-2-yl)-2-furyl]methylene]-4-keto-2-thioxo-thiazolidin-3-yl]propionic acid | 3-[(5Z)-5-[[5-(1,3-benzothiazol-2-yl)furan-2-yl]methylidene]-4-oxidanylidene-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | 3-[(5Z)-5-[[5-(1,3-benzothiazol-2-yl)furan-2-yl]methylidene]-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]propanoic acid | 3-{5-[1-(5-Benzothiazol-2-yl-furan-2-yl)-meth-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid | MLS000551806 | SMR000145731 | US20230364057, Compound 27 | cid_2030972 |
Type | Small organic molecule |
Emp. Form. | C18H12N2O4S3 |
Mol. Mass. | 416.494 |
SMILES | OC(=O)CCN1C(=S)S\C(=C/c2ccc(o2)-c2nc3ccccc3s2)C1=O |
Structure |
|