| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 26S proteasome non-ATPase regulatory subunit 14 |
|---|
| Ligand | BDBM76125 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay |
|---|
| IC50 | 7640±1740 nM |
|---|
| Citation |  PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 26S proteasome non-ATPase regulatory subunit 14 |
|---|
| Name: | 26S proteasome non-ATPase regulatory subunit 14 |
|---|
| Synonyms: | 26S Proteasome regulatory subunit Rpn11 (Rpn11) | POH1 | PSDE_HUMAN | PSMD14 | PSMD14 protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 34576.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O00487 |
|---|
| Residue: | 310 |
|---|
| Sequence: | MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
|
|
|
|---|
| BDBM76125 |
|---|
| n/a |
|---|
| Name | BDBM76125 |
|---|
| Synonyms: | (3-butyl-7-methyl-6,8-dioxoisochromen-7-yl) cyclopentanecarboxylate | CMLD003384 | MLS000438302 | SMR000452562 | [3-butyl-7-methyl-6,8-bis(oxidanylidene)isochromen-7-yl] cyclopentanecarboxylate | cid_16745542 | cyclopentanecarboxylic acid (3-butyl-6,8-diketo-7-methyl-isochromen-7-yl) ester | cyclopentanecarboxylic acid (3-butyl-7-methyl-6,8-dioxo-2-benzopyran-7-yl) ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24O5 |
|---|
| Mol. Mass. | 344.4016 |
|---|
| SMILES | CCCCC1=CC2=CC(=O)C(C)(OC(=O)C3CCCC3)C(=O)C2=CO1 |c:24,t:4,6| |
|---|
| Structure | 
|
|---|
Search and Browse
