BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM66443
Substrate/Competitorn/a
Meas. Tech.Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC
EC50 8440±n/a nM
Citation PubChem PC Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC PubChem Bioassay (2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM66443
n/a
NameBDBM66443
Synonyms:1-(4-Chloro-benzoyl)-1-ethyl-2-oxo-1,7b-dihydro-cyclopropa[c]chromene-1a-carboxylic acid phenylamide | 1-(4-chlorobenzoyl)-1-ethyl-2-keto-N-phenyl-7bH-cyclopropa[c]chromene-1a-carboxamide | 1-(4-chlorobenzoyl)-1-ethyl-2-oxo-N-phenyl-7bH-cyclopropa[c]chromene-1a-carboxamide | 1-(4-chlorophenyl)carbonyl-1-ethyl-2-oxidanylidene-N-phenyl-7bH-cyclopropa[c]chromene-1a-carboxamide | 1-[(4-chlorophenyl)-oxomethyl]-1-ethyl-2-oxo-N-phenyl-7bH-cyclopropa[c][1]benzopyran-1a-carboxamide | MLS000580328 | SMR000220559 | cid_3327006
TypeSmall organic molecule
Emp. Form.C26H20ClNO4
Mol. Mass.445.894
SMILESCCC1(C2c3ccccc3OC(=O)C12C(=O)Nc1ccccc1)C(=O)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: