BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM83397
Substrate/Competitorn/a
Meas. Tech.Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC
EC50 8400±n/a nM
Citation PubChem PC Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC PubChem Bioassay (2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM83397
n/a
NameBDBM83397
Synonyms:2-(2,4-dimethoxy-3-methyl-benzyl)-1,3,4,9-tetrahydro-beta-carboline | 2-(2,4-dimethoxy-3-methylbenzyl)-2,3,4,9-tetrahydro-1H-beta-carboline | 2-[(2,4-dimethoxy-3-methyl-phenyl)methyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole | 2-[(2,4-dimethoxy-3-methylphenyl)methyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole | MLS001000473 | SMR000496078 | cid_785909
TypeSmall organic molecule
Emp. Form.C21H24N2O2
Mol. Mass.336.4275
SMILESCOc1ccc(CN2CCc3c(C2)[nH]c2ccccc32)c(OC)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: