Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 14
LigandBDBM113067
Substrate/Competitorn/a
Meas. Tech.KLK14 Assay
pH8±n/a
Temperature310.15±n/a K
Ki 500±n/a nM
Commentsextracted
Citation Wagberg FLeonardsson G Benzoxazinone derivatives for treatment of skin diseases US Patent  US9695194 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 14
Name:Kallikrein 14
Synonyms:KLK-L6 | Kallikrein-14 | Kallikrein-like protein 6 | hK14
Type:PROTEIN
Mol. Mass.:29136.99
Organism:Homo sapiens (Human)
Description:ChEMBL_1282452
Residue:267
Sequence:
MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
CALPGYPGVYTNLCKYRSWIEETMRDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113067
n/a
NameBDBM113067
Synonyms:US9695194, 3
TypeSmall organic molecule
Emp. Form.C19H19NO6
Mol. Mass.357.3573
SMILESCCOc1cc2c(cc1OC)nc(oc2=O)-c1ccc(OC)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: