Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM113069
Substrate/Competitorn/a
Meas. Tech.Cathepsin G Assay
pH7.2±n/a
Temperature310.15±n/a K
Ki 1200±n/a nM
Commentsextracted
Citation Wagberg FLeonardsson G Benzoxazinone derivatives for treatment of skin diseases US Patent  US9695194 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113069
n/a
NameBDBM113069
Synonyms:US9695194, 5
TypeSmall organic molecule
Emp. Form.C18H17NO5
Mol. Mass.327.3313
SMILESCCOc1cc2c(cc1OC)nc(oc2=O)-c1ccccc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: