Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome CYP26A1
LigandBDBM50253810
Substrate/Competitorn/a
Meas. Tech.Cell Assay
EC50 5±0 nM
Citation Pautus SAboraia ASBassett CEBrancale ACoogan MPSimons C Design and synthesis of substituted imidazole and triazole N-phenylbenzo[d]oxazolamine inhibitors of retinoic acid metabolizing enzyme CYP26. J Enzyme Inhib Med Chem 24:487-98 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome CYP26A1
Name:Cytochrome CYP26A1
Synonyms:Cytochrome P450 26A1 | Cytochrome P450 retinoic acid-inactivating 1 | Retinoic acid 4-hydroxylase
Type:Enzyme
Mol. Mass.:56216.16
Organism:Homo sapiens (Human)
Description:O43174
Residue:497
Sequence:
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50253810
n/a
NameBDBM50253810
Synonyms:CHEMBL459505 | N-(4-(2-ethyl-1-(1H-1,2,4-triazol-1-yl)butyl)phenyl)benzo[d]thiazol-2-amine | R-115866 | R115866
TypeSmall organic molecule
Emp. Form.C21H23N5S
Mol. Mass.377.506
SMILESCCC(CC)C(c1ccc(Nc2nc3ccccc3s2)cc1)n1cncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: