BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT3A Serotonin Receptor
LigandBDBM91603
Substrate/Competitorn/a
Meas. Tech.Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates.
pH7.4±n/a
Temperature310.15±n/a K
Ki 900±n/a nM
Citation Yamauchi JGGomez KGrimster NDufouil MNemecz AFotsing JRHo KTalley TTSharpless KFokin VVTaylor P Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates. Taylor Research Group 0:0 (2014)    Article
More Info.:Get all data from this article,  Assay Method
 
5-HT3A Serotonin Receptor
Name:5-HT3A Serotonin Receptor
Synonyms:5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor
Type:n/a
Mol. Mass.:56056.00
Organism:Mus musculus (house mouse)
Description:5HT3A
Residue:487
Sequence:
MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91603
n/a
NameBDBM91603
Synonyms:4' | alpha7 agonists 4'
Typen/a
Emp. Form.C22H30N5O
Mol. Mass.380.506
SMILESCN1CC=C(OCc2cnnn2C2CC3CCC(C2)[N+]3(C)C)c2ccccc12 |t:3,TLB:11:12:19:15.16|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: