new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-7
LigandBDBM91619
Substrate/Competitorn/a
Meas. Tech.Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates.
pH7.4±n/a
Temperature310.15±n/a K
EC50 2000±n/a nM
Citation Yamauchi JGGomez KGrimster NDufouil MNemecz AFotsing JRHo KTalley TTSharpless KFokin VVTaylor P Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates. Taylor Research Group 0:0 (2014)    Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit alpha-7
Name:Neuronal acetylcholine receptor subunit alpha-7
Synonyms:CHRNA7 | Cholinergic, Nicotinic Alpha7 | NACHRA7 | Neuronal acetylcholine receptor protein alpha-7 subunit | Neuronal acetylcholine receptor subunit alpha-7 (nAChR-alpha 7) | Nicotinic acetylcholine receptor alpha-7 (alpha7 nAChR)
Type:n/a
Mol. Mass.:56448.33
Organism:Homo sapiens (Human)
Description: CHRNA7 (NACHRA7)
Residue:502
Sequence:
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91619
n/a
NameBDBM91619
Synonyms:19q | alpha7 agonists 19q
Typen/a
Emp. Form.C19H24F3N4O
Mol. Mass.381.4147
SMILESC[N+]1(C)[C@H]2CC[C@@H]1C[C@H](C2)n1cc(nn1)C(O)(c1ccccc1)C(F)(F)F |THB:10:8:4.5:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: