new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM91618
Substrate/Competitorn/a
Meas. Tech.Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates.
pH7.4±n/a
Temperature293.15±n/a K
Ki 270±n/a nM
Citation Yamauchi JGGomez KGrimster NDufouil MNemecz AFotsing JRHo KTalley TTSharpless KFokin VVTaylor P Synthesizing Selective Agonists for the ?7 Nicotinic Receptor with in situ Click-Chemistry on Acetylcholine Binding Protein Templates. Taylor Research Group 0:0 (2014)    Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:Soluble acetylcholine receptor
Type:n/a
Mol. Mass.:26560.08
Organism:Aplysia Californica
Description:Q8WSF8
Residue:236
Sequence:
MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKA
DSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLS
PQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQV
DLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91618
n/a
NameBDBM91618
Synonyms:18q | alpha7 agonists 18q
Typen/a
Emp. Form.C23H33N4O
Mol. Mass.381.5338
SMILESC[N+]1(C)[C@H]2CC[C@@H]1C[C@H](C2)n1cc(COc2ccccc2C2CCCC2)nn1 |THB:10:8:1:5.4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: