Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
---|
Ligand | BDBM92358 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhbition Assay |
---|
pH | 7.6±0 |
---|
Temperature | 310.15±0 K |
---|
Ki | 0.65±0.04 nM |
---|
Citation | Hazleton, KZ; Ho, MC; Cassera, MB; Clinch, K; Crump, DR; Rosario, I; Merino, EF; Almo, SC; Tyler, PC; Schramm, VL Acyclic Immucillin Phosphonates: Second-Generation Inhibitors of Plasmodium falciparum Hypoxanthine- Guanine-Xanthine Phosphoribosyltransferase. Chem Biol19:721-30 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine-xanthine phosphoribosyltransferase |
Synonyms: | HGXR_PLAFG | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) | Hypoxanthine-guanine-xanthine phosphoribosyltransferase (PfHGXPRT) | LACZ |
Type: | Protein |
Mol. Mass.: | 26352.14 |
Organism: | Plasmodium falciparum |
Description: | P20035 |
Residue: | 231 |
Sequence: | MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQ
STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL
WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL
|
|
|
BDBM92358 |
---|
n/a |
---|
Name | BDBM92358 |
Synonyms: | HGXPRT Inhibitor, 3 |
Type | Small organic molecule |
Emp. Form. | C10H14N4O5P |
Mol. Mass. | 301.2163 |
SMILES | OC[C@H](CCP([O-])([O-])=O)[NH2+]c1c[nH]c2c1nc[nH]c2=O |r| |
Structure |
|