Reaction Details |
| Report a problem with these data |
Target | Acetylcholine-binding protein |
---|
Ligand | BDBM50004108 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Radioligand Competition Assay |
---|
Ki | 83±10 nM |
---|
Citation | Rohde, LA; Ahring, PK; Jensen, ML; Nielsen, EØ; Peters, D; Helgstrand, C; Krintel, C; Harpsøe, K; Gajhede, M; Kastrup, JS; Balle, T Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine α4β2 receptors: unique role of halogen bonding revealed. J Biol Chem287:4248-59 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Acetylcholine-binding protein |
---|
Name: | Acetylcholine-binding protein |
Synonyms: | ACHP_LYMST | ACh-binding protein | Acetylcholine Binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP |
Type: | n/a |
Mol. Mass.: | 26055.52 |
Organism: | Lymnaea stagnalis |
Description: | Soluble acetylcholine receptor |
Residue: | 229 |
Sequence: | MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
|
|
|
BDBM50004108 |
---|
n/a |
---|
Name | BDBM50004108 |
Synonyms: | (+-)-nicotine | (R,S)-nicotine | (RS)-nicotine | 3-(1-methylpyrrolidin-2-yl)pyridine | CHEMBL440464 | Nicotin | Nicotine-(+) | Nikotin | US11667638, Example Nicotine | US8609708, 54 Nicotine | US9284322, Nicotine | US9993465, Nicotine | nicotine |
Type | Small organic molecule |
Emp. Form. | C10H14N2 |
Mol. Mass. | 162.2316 |
SMILES | CN1CCCC1c1cccnc1 |
Structure |
|