| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acetylcholine-binding protein |
|---|
| Ligand | BDBM50088438 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radioligand Competition Assay |
|---|
| Ki | 3.1±0.9 nM |
|---|
| Citation |  Rohde, LA; Ahring, PK; Jensen, ML; Nielsen, EØ; Peters, D; Helgstrand, C; Krintel, C; Harpsøe, K; Gajhede, M; Kastrup, JS; Balle, T Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine α4β2 receptors: unique role of halogen bonding revealed. J Biol Chem287:4248-59 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acetylcholine-binding protein |
|---|
| Name: | Acetylcholine-binding protein |
|---|
| Synonyms: | ACHP_LYMST | ACh-binding protein | Acetylcholine Binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 26055.52 |
|---|
| Organism: | Lymnaea stagnalis |
|---|
| Description: | Soluble acetylcholine receptor |
|---|
| Residue: | 229 |
|---|
| Sequence: | MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
|
|
|
|---|
| BDBM50088438 |
|---|
| n/a |
|---|
| Name | BDBM50088438 |
|---|
| Synonyms: | 1-(pyridin-3-yl)-1,4-diazepane | 1-Pyridin-3-yl-[1,4]diazepane | CHEMBL71085 | NS3531, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H15N3 |
|---|
| Mol. Mass. | 177.2462 |
|---|
| SMILES | C1CNCCN(C1)c1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
