Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM50088454
Substrate/Competitorn/a
Meas. Tech.Radioligand Competition Assay
Ki 1.3±0.9 nM
Citation Rohde LAAhring PKJensen MLNielsen EØPeters DHelgstrand CKrintel CHarpsøe KGajhede MKastrup JSBalle T Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine α4β2 receptors: unique role of halogen bonding revealed. J Biol Chem 287:4248-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:ACh-binding protein | Acetylcholine-binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP
Type:n/a
Mol. Mass.:26055.52
Organism:Lymnaea stagnalis
Description:Soluble acetylcholine receptor
Residue:229
Sequence:
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088454
n/a
NameBDBM50088454
Synonyms:1-(6-Bromo-pyridin-3-yl)-[1,4]diazepane | 1-(6-bromopyridin-3-yl)-1,4-diazepane | CHEMBL306387 | NS3920, 4
TypeSmall organic molecule
Emp. Form.C10H14BrN3
Mol. Mass.256.142
SMILESBrc1ccc(cn1)N1CCCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: