Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM50088453
Substrate/Competitorn/a
Meas. Tech.Radioligand Competition Assay
Ki 0.25±0.05 nM
Citation Rohde LAAhring PKJensen MLNielsen EØPeters DHelgstrand CKrintel CHarpsøe KGajhede MKastrup JSBalle T Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine α4β2 receptors: unique role of halogen bonding revealed. J Biol Chem 287:4248-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:CHRNA4 | Cholinergic, Nicotinic Alpha4Beta2 | Cholinergic, Nicotinic Alpha4Beta4 | Neuronal acetylcholine receptor (alpha4beta2 nAChR) | Neuronal acetylcholine receptor protein alpha-4 subunit | Neuronal acetylcholine receptor subunit alpha 4 beta 2 | Neuronal acetylcholine receptor subunit alpha-4
Type:Enzyme
Mol. Mass.:70196.44
Organism:Rattus norvegicus (Rat)
Description:P09483
Residue:630
Sequence:
MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
PTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLF
MKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAV
ETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQ
EAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKE
PSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFIIVCLLGTVGLFLPPWLAAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088453
n/a
NameBDBM50088453
Synonyms:1-(6-Bromo-5-ethoxy-pyridin-3-yl)-[1,4]diazepane | 1-(6-bromo-5-ethoxypyridin-3-yl)-1,4-diazepane | CHEMBL72433 | NS3570, 5
TypeSmall organic molecule
Emp. Form.C12H18BrN3O
Mol. Mass.300.195
SMILESCCOc1cc(cnc1Br)N1CCCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: