| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Genome polyprotein [1027-1206,R1052K] |
|---|
| Ligand | BDBM92408 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 8±0 |
|---|
| Ki | 1.89±0.06 nM |
|---|
| KOFF | 22E-4 s-1 |
|---|
| KON | 11E5 M-1s-1 |
|---|
| Citation |  Lemke, CT; Goudreau, N; Zhao, S; Hucke, O; Thibeault, D; Llinás-Brunet, M; White, PW Combined X-ray, NMR, and kinetic analyses reveal uncommon binding characteristics of the hepatitis C virus NS3-NS4A protease inhibitor BI 201335. J Biol Chem286:11434-43 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Genome polyprotein [1027-1206,R1052K] |
|---|
| Name: | Genome polyprotein [1027-1206,R1052K] |
|---|
| Synonyms: | HCV NS3 Proteinase | NS3-NS4A Protein | POLG_HCVCO |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 18947.03 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | HCV (BK strain) NS3 protein region from amino acid 1 to 180, harboring a C-terminal poly Lys solubilization motif (ASKKKK). |
|---|
| Residue: | 180 |
|---|
| Sequence: | APITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAG
SKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
|
|
|
|---|
| BDBM92408 |
|---|
| n/a |
|---|
| Name | BDBM92408 |
|---|
| Synonyms: | NS3 protease inhibitor, analog 1 |
|---|
| Type | Peptide |
|---|
| Emp. Form. | C40H50N6O9S |
|---|
| Mol. Mass. | 790.925 |
|---|
| SMILES | COc1ccc2c(O[C@@H]3CC(N(C3)C(=O)[C@@H](NC(=O)OC3CCCC3)C(C)(C)C)C(=O)N[C@@]3(CC3C=C)C(O)=O)cc(nc2c1)-c1csc(NC(=O)C(C)C)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
