Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM-kinase kinase beta
LigandBDBM92455
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.5±0
Temperature303.15±0 K
IC50 5.0e+2± 0 nM
Citation Kukimoto-Niino MYoshikawa STakagi TOhsawa NTomabechi YTerada TShirouzu MSuzuki ALee SYamauchi TOkada-Iwabu MIwabu MKadowaki TMinokoshi YYokoyama S Crystal structure of the Ca2+/calmodulin-dependent protein kinase kinase in complex with the inhibitor STO-609. J Biol Chem 286:22570-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CaM-kinase kinase beta
Name:CaM-kinase kinase beta
Synonyms:Calcium/calmodulin-dependent protein kinase kinase 2 (CaMKKB) | Calcium/calmodulin-dependent protein kinase kinase beta
Type:Enzyme Catalytic Domain
Mol. Mass.:64746.61
Organism:Homo sapiens (Human)
Description:gi_27437015
Residue:588
Sequence:
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92455
n/a
NameBDBM92455
Synonyms:CHEMBL265470 | STO-609
TypeSmall organic molecule
Emp. Form.C19H10N2O3
Mol. Mass.314.2943
SMILESOC(=O)c1ccc2c3nc4ccccc4n3c(=O)c3cccc1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: