Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphoehtnaolamine Methyltransferases 2 (PMT2)
LigandBDBM8961
Substrate/Competitorn/a
Meas. Tech.Radiochemical Assay
pH8±0
Temperature298.15±0 K
IC50 3500000±500000 nM
Citation Lee SGHaakenson WMcCarter JPWilliams DJHresko MCJez JM Thermodynamic evaluation of ligand binding in the plant-like phosphoethanolamine methyltransferases of the parasitic nematode Haemonchus contortus. J Biol Chem 286:38060-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Phosphoehtnaolamine Methyltransferases 2 (PMT2)
Name:Phosphoehtnaolamine Methyltransferases 2 (PMT2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:49764.45
Organism:Caenorhabditis elegans
Description:Q22993
Residue:437
Sequence:
MSSLSIPRQSLYYVNKVTEGRSVSNVQVVSPCQKQGQTYVTAFTPLTSNVQVHTSLEQLS
TIRNADVLIFNNALSQIITNADLLTDFLKNATNATAIGGTVIIREDLKDCSDKRQVARLT
DYFDVFRTTDSDGNNTGLDLYTVDQVEHSNYVEQNFLDFIFVFRKKVFAPTTDATITFRD
FLDKTQYTNTGIDAYEWMFGVNFISPGGYDENLKIIKRFGDFKPGQTMLDIGVGIGGGAR
QVADEFGVHVHGIDLSSNMLAIALERLHEEKDSRVKYSITDALVYQFEDNSFDYVFSRDC
IQHIPDTEKLFSRIYKALKPGGKVLITMYGKGYGEQSDKFKTYVAQRAYFLKNLKEIADI
ANKTGFVNVQTENMTPRFKEILLEERGHLEQNEAEFMSKFTQRERDSLISGWTDKLGYIE
KDNHNWNFFLAQKPFPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
n/a
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: